Back to Previous Page

PEPTIDE 46 708P

ITEM#: 2918-46708P

MFR#: 46-708P

PEPTIDE 46 708P - 46-708P

See More Details
PEPTIDE 46 708P - 46-708P
Provide Content Correction
Product Name Description Item# QTY
PEPTIDE 42 708P PEPTIDE 42 708P - 42-708P 2918-42708P EA
PEPTIDE 43 708P PEPTIDE 43 708P - 43-708P 2918-43708P EA
PEPTIDE 45 708P PEPTIDE 45 708P - 45-708P 2918-45708P EA
PNMA6A RECOM PRO NBP246708PEP Novus Biologicals PNMA6A Recombinant Protein Antigen, Protein Length: GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF, Common Name: PNMA6A Recombinant Protein Antigen, Content And Storage: Store at -20 deg.C short t 4797-NBP246708PEP EA
PEPTIDE 46 571P PEPTIDE 46 571P - 46-571P 2918-46571P EA
Thank you for visiting. We look forward to serving you!

Read more about us:  Franklin Young Value



For Government, Military, Education and Government Prime Access:


New Customers Existing Customers

Please contact Customer Service with your questions.

Thank you for visiting, your account is pending approval.

You will received email notification for approval within 24hrs.

Contact customerservice@franklinyoung.com for any questions.

Thank you for requesting an account with Franklin Young.

Your request has been declined

We restrict website access to government entities, and related customers.

Please contact customerservice@franklinyoung.com with any questions.