Back to Previous Page

PNMA6A - 100 UL

ITEM#: 4797-NBP288070

MFR#: NBP2-88070

Antigen: PNMA6A, Host Species: Rabbit, Target Species: Human, Applications: Western Blot, Primary or Secondary: Primary, Concentration: 0.5 mg/ml, Conjugate: Unconjugated, Quantity: 100 uL

See More Details
Antigen: PNMA6A, Host Species: Rabbit, Target Species: Human, Applications: Western Blot, Primary or Secondary: Primary, Concentration: 0.5 mg/ml, Conjugate: Unconjugated, Quantity: 100 uL
Provide Content Correction
Product Name Description Item# QTY
PNMA6A - 25UL Pnma6a - 25ul 4797-NBP24680025UL EA
PNMA6A - 25UL Pnma6a - 25ul 4797-NBP24670825UL EA
PNMA6A - 0.05 MG PNMA6A Antibody, Novus Biologicals 4797-NBP179867 EA
PNMA6A RECOM PRO NBP246800PEP Novus Biologicals PNMA6A Recombinant Protein Antigen, Protein Length: IPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVN, Common Name: PNMA6A Recombinant Protein Antigen, Content And Storage: Store at -20 deg.C short term. Avoid freeze-thaw 4797-NBP246800PEP EA
PNMA6A RECOM PRO NBP246708PEP Novus Biologicals PNMA6A Recombinant Protein Antigen, Protein Length: GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF, Common Name: PNMA6A Recombinant Protein Antigen, Content And Storage: Store at -20 deg.C short t 4797-NBP246708PEP EA
Thank you for visiting. We look forward to serving you!

Read more about us:  Franklin Young Value



For Government, Military, Education and Government Prime Access:


New Customers Existing Customers

Please contact Customer Service with your questions.

Thank you for visiting, your account is pending approval.

You will received email notification for approval within 24hrs.

Contact customerservice@franklinyoung.com for any questions.

Thank you for requesting an account with Franklin Young.

Your request has been declined

We restrict website access to government entities, and related customers.

Please contact customerservice@franklinyoung.com with any questions.