Back to Previous Page

PNMA6A RECOM PRO NBP246708PEP

ITEM#: 4797-NBP246708PEP

MFR#: NBP2-46708PEP

Novus Biologicals PNMA6A Recombinant Protein Antigen, Protein Length: GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF, Common Name: PNMA6A Recombinant Protein Antigen, Content And Storage: Store at -20 deg.C short t

See More Details
Novus Biologicals PNMA6A Recombinant Protein Antigen, Protein Length: GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF, Common Name: PNMA6A Recombinant Protein Antigen, Content And Storage: Store at -20 deg.C short t
Provide Content Correction
Product Name Description Item# QTY
PNMA6A RECOM PRO NBP246800PEP Novus Biologicals PNMA6A Recombinant Protein Antigen, Protein Length: IPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVN, Common Name: PNMA6A Recombinant Protein Antigen, Content And Storage: Store at -20 deg.C short term. Avoid freeze-thaw 4797-NBP246800PEP EA
PNMA6A - 25UL Pnma6a - 25ul 4797-NBP24680025UL EA
PNMA6A - 25UL Pnma6a - 25ul 4797-NBP24670825UL EA
PNMA6A - 0.05 MG PNMA6A Antibody, Novus Biologicals 4797-NBP179867 EA
PNMA6A - 100 UL Antigen: PNMA6A, Host Species: Rabbit, Target Species: Human, Applications: Western Blot, Primary or Secondary: Primary, Concentration: 0.5 mg/ml, Conjugate: Unconjugated, Quantity: 100 uL 4797-NBP288070 EA
Thank you for visiting. We look forward to serving you!

Read more about us:  Franklin Young Value



For Government, Military, Education and Government Prime Access:


New Customers Existing Customers

Please contact Customer Service with your questions.

Thank you for visiting, your account is pending approval.

You will received email notification for approval within 24hrs.

Contact customerservice@franklinyoung.com for any questions.

Thank you for requesting an account with Franklin Young.

Your request has been declined

We restrict website access to government entities, and related customers.

Please contact customerservice@franklinyoung.com with any questions.