EMAIL US: customerservice@franklinyoung.com
CALL US: (618) 724-2780 / (909) 931-5012
CALL US: (618) 724-2780 / (909) 931-5012
Back to Previous Page
ITEM#: 2946-3418500U
MFR#: 3418/500U
Amylin, endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors. Inhibits glucagon secretion, delays gastric emptying, acts as a satiety agent, displays glucose lowering effects in vivo. 500ug, Tocris Bioscience
| Product Name | Description | Item# | QTY | |
|---|---|---|---|---|
Calcitonin (human), 500ug, endogenous receptor agonist, Tocris Bioscience
|
Calcitonin (human), 500ug, endogenous calcitonin receptor agonist; inhibits bone resorption; lowers systemic blood calcium. Lyophilized peptide, sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, molecular weight: 3417.87, CAS: 21215-62-3, store at -20 deg. | 2946-6031500U | EA | |
|
Retinoic acid, endogenous RAR agonist, 50mg, Tocris Bioscience
|
Retinoic acid, 50mg, endogenous RAR agonist (IC50=14 nM), promotes mouse ESC differentiation to adipocytes, neurons, glia in vitro, proposed ROR ligand (Kd=280 nM), activates autophagy, Tocris Bioscience | 2946-069550 | EA | |
|
AC 187, potent amylin receptor antagonist, 500ug, Tocris Bioscience
|
AC 187, potent orally active amylin receptor antagonist (IC50=0.48 nM). 38-fold and 400-fold selectivity over calcitonin and CGRP. Blocks amyloid-induced neurotoxicity in vitro; affects glucagon, gastric emptying, plasma glucose, food intake in vivo. | 2946-3419500U | EA | |
|
Tocris Bioscience CRF (human, rat), endogenous peptide, 200ug
|
Tocris Bioscience CRF (human, rat), endogenous peptide agonist for the CRF receptor (Ki: 11 nM hCRF1, 44 nM rCRF2a, 38 nM mCRF2b), stimulates ACTH synthesis and release, 200ug | 2946-1151200U | EA | |
|
Somatostatin 1-28, sst receptor agonist, 500ug, Tocris Bioscience
|
Tocris Bioscience Somatostatin 1-28, 500ug. Somatostatin receptor agonist derived from post-translational cleavage of prosomatostatin. | 2946-1165500U | EA |