EMAIL US: customerservice@franklinyoung.com
CALL US: (618) 724-2780 / (909) 931-5012
CALL US: (618) 724-2780 / (909) 931-5012
Back to Previous Page
ITEM#: 2946-6031500U
MFR#: 6031/500U
Calcitonin (human), 500ug, endogenous calcitonin receptor agonist; inhibits bone resorption; lowers systemic blood calcium. Lyophilized peptide, sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, molecular weight: 3417.87, CAS: 21215-62-3, store at -20 deg.
| Product Name | Description | Item# | QTY | |
|---|---|---|---|---|
Amylin, endogenous peptide agonist, 500ug, Tocris Bioscience
|
Amylin, endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors. Inhibits glucagon secretion, delays gastric emptying, acts as a satiety agent, displays glucose lowering effects in vivo. 500ug, Tocris Bioscience | 2946-3418500U | EA | |
|
Somatostatin 1-28, sst receptor agonist, 500ug, Tocris Bioscience
|
Tocris Bioscience Somatostatin 1-28, 500ug. Somatostatin receptor agonist derived from post-translational cleavage of prosomatostatin. | 2946-1165500U | EA | |
|
Retinoic acid, endogenous RAR agonist, 50mg, Tocris Bioscience
|
Retinoic acid, 50mg, endogenous RAR agonist (IC50=14 nM), promotes mouse ESC differentiation to adipocytes, neurons, glia in vitro, proposed ROR ligand (Kd=280 nM), activates autophagy, Tocris Bioscience | 2946-069550 | EA | |
|
Purmorphamine, Smo receptor agonist, 10mg, Tocris Bioscience
|
Purmorphamine, Smo receptor agonist, 10mg, activates Hedgehog pathway, induces osteogenesis in mouse mesenchymal progenitor cells, transdifferentiates pre-adipocytes and myoblasts with BMP-4, induces osteoblast and spinal motor neuron differentiation | 2946-455110 | EA | |
|
DAMGO, selective opioid receptor agonist, 1mg, Tocris Bioscience
|
DAMGO, highly selective peptide agonist for the opioid receptor. Supplied as 1mg by Tocris Bioscience. | 2946-11711 | EA |