EMAIL US: customerservice@franklinyoung.com
CALL US: (618) 724-2780 / (909) 931-5012
CALL US: (618) 724-2780 / (909) 931-5012
Back to Previous Page
ITEM#: 2946-1165500U
MFR#: 1165/500U
Tocris Bioscience Somatostatin 1-28, 500ug. Somatostatin receptor agonist derived from post-translational cleavage of prosomatostatin.
| Product Name | Description | Item# | QTY | |
|---|---|---|---|---|
Calcitonin (human), 500ug, endogenous receptor agonist, Tocris Bioscience
|
Calcitonin (human), 500ug, endogenous calcitonin receptor agonist; inhibits bone resorption; lowers systemic blood calcium. Lyophilized peptide, sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, molecular weight: 3417.87, CAS: 21215-62-3, store at -20 deg. | 2946-6031500U | EA | |
|
Amylin, endogenous peptide agonist, 500ug, Tocris Bioscience
|
Amylin, endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors. Inhibits glucagon secretion, delays gastric emptying, acts as a satiety agent, displays glucose lowering effects in vivo. 500ug, Tocris Bioscience | 2946-3418500U | EA | |
|
Purmorphamine, Smo receptor agonist, 10mg, Tocris Bioscience
|
Purmorphamine, Smo receptor agonist, 10mg, activates Hedgehog pathway, induces osteogenesis in mouse mesenchymal progenitor cells, transdifferentiates pre-adipocytes and myoblasts with BMP-4, induces osteoblast and spinal motor neuron differentiation | 2946-455110 | EA | |
|
Liraglutide, 1 mg, GLP-1 receptor agonist, Tocris Bioscience
|
Liraglutide, 1 mg, highly potent, long-acting GLP-1 receptor agonist (EC50 = 61 pM), acylated GLP-1 (7-37) derivative, inhibits food and water intake, causes reversible weight loss in rats, reduces amyloid and neuroinflammation in Alzheimer's model, | 2946-65171 | EA | |
|
SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience
|
SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience. Ki=9.64 M, IC50=10.4 M. Sequence: Ser-Leu-Ile-Gly-Lys-Val-NH2. Corresponds to tethered ligand exposed by trypsin cleavage of PAR-2. | 2946-30105 | EA |