Back to Previous Page

SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience

ITEM#: 2946-30105

MFR#: 3010/5

SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience. Ki=9.64 M, IC50=10.4 M. Sequence: Ser-Leu-Ile-Gly-Lys-Val-NH2. Corresponds to tethered ligand exposed by trypsin cleavage of PAR-2.

See More Details
SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience. Ki=9.64 M, IC50=10.4 M. Sequence: Ser-Leu-Ile-Gly-Lys-Val-NH2. Corresponds to tethered ligand exposed by trypsin cleavage of PAR-2.
Provide Content Correction
Product Name Description Item# QTY
Purmorphamine, Smo receptor agonist, 10mg, Tocris Bioscience Purmorphamine, Smo receptor agonist, 10mg, activates Hedgehog pathway, induces osteogenesis in mouse mesenchymal progenitor cells, transdifferentiates pre-adipocytes and myoblasts with BMP-4, induces osteoblast and spinal motor neuron differentiation 2946-455110 EA
DAMGO, selective opioid receptor agonist, 1mg, Tocris Bioscience DAMGO, highly selective peptide agonist for the opioid receptor. Supplied as 1mg by Tocris Bioscience. 2946-11711 EA
Calcitonin (human), 500ug, endogenous receptor agonist, Tocris Bioscience Calcitonin (human), 500ug, endogenous calcitonin receptor agonist; inhibits bone resorption; lowers systemic blood calcium. Lyophilized peptide, sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, molecular weight: 3417.87, CAS: 21215-62-3, store at -20 deg. 2946-6031500U EA
2-Furoyl-LIGRLO-amide, potent selective PAR2 agonist, 1mg, Tocris Bioscience 2-Furoyl-LIGRLO-amide from Tocris Bioscience, potent and selective PAR2 agonist (pD2 = 7.0), induces dose-dependent relaxation of murine femoral arteries, quantity: 1mg 2946-30151 EA
FTY 720, 10mg, S1P receptor agonist, immunosuppressant, Tocris Bioscience FTY 720, 10mg, potent S1P receptor agonist; phosphorylated by sphingosine kinase 2, binds S1P1,3,4,5 (EC50 0.3-3 nM); immunosuppressant; sequesters lymphocytes; suppresses EAE; orally bioavailable; blood-brain barrier permeable; CAS: 162359-56-0; for 2946-617610 EA
Thank you for visiting. We look forward to serving you!

Read more about us:  Franklin Young Value



For Government, Military, Education and Government Prime Access:


New Customers Existing Customers

Please contact Customer Service with your questions.

Thank you for visiting, your account is pending approval.

You will received email notification for approval within 24hrs.

Contact customerservice@franklinyoung.com for any questions.

Thank you for requesting an account with Franklin Young.

Your request has been declined

We restrict website access to government entities, and related customers.

Please contact customerservice@franklinyoung.com with any questions.