EMAIL US: customerservice@franklinyoung.com
CALL US: (618) 724-2780 / (909) 931-5012
CALL US: (618) 724-2780 / (909) 931-5012
Back to Previous Page
ITEM#: 2946-455110
MFR#: 4551/10
Purmorphamine, Smo receptor agonist, 10mg, activates Hedgehog pathway, induces osteogenesis in mouse mesenchymal progenitor cells, transdifferentiates pre-adipocytes and myoblasts with BMP-4, induces osteoblast and spinal motor neuron differentiation
| Product Name | Description | Item# | QTY | |
|---|---|---|---|---|
FTY 720, 10mg, S1P receptor agonist, immunosuppressant, Tocris Bioscience
|
FTY 720, 10mg, potent S1P receptor agonist; phosphorylated by sphingosine kinase 2, binds S1P1,3,4,5 (EC50 0.3-3 nM); immunosuppressant; sequesters lymphocytes; suppresses EAE; orally bioavailable; blood-brain barrier permeable; CAS: 162359-56-0; for | 2946-617610 | EA | |
|
ATPgammaS tetralithium salt, P2 agonist, 10mg, Tocris Bioscience
|
Tocris Bioscience ATPgammaS tetralithium salt, non-selective P2 agonist, nonhydrolyzable ATP analog (Cat. No. 3245), purity >90%, 10mg, molecular weight: 546.98, store at -20 deg.C | 2946-408010 | EA | |
|
SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience
|
SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience. Ki=9.64 M, IC50=10.4 M. Sequence: Ser-Leu-Ile-Gly-Lys-Val-NH2. Corresponds to tethered ligand exposed by trypsin cleavage of PAR-2. | 2946-30105 | EA | |
|
Calcitonin (human), 500ug, endogenous receptor agonist, Tocris Bioscience
|
Calcitonin (human), 500ug, endogenous calcitonin receptor agonist; inhibits bone resorption; lowers systemic blood calcium. Lyophilized peptide, sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, molecular weight: 3417.87, CAS: 21215-62-3, store at -20 deg. | 2946-6031500U | EA | |
|
DAMGO, selective opioid receptor agonist, 1mg, Tocris Bioscience
|
DAMGO, highly selective peptide agonist for the opioid receptor. Supplied as 1mg by Tocris Bioscience. | 2946-11711 | EA |