Back to Previous Page

DAMGO, selective opioid receptor agonist, 1mg, Tocris Bioscience

ITEM#: 2946-11711

MFR#: 1171/1

DAMGO, highly selective peptide agonist for the opioid receptor. Supplied as 1mg by Tocris Bioscience.

See More Details
DAMGO, highly selective peptide agonist for the opioid receptor. Supplied as 1mg by Tocris Bioscience.
Provide Content Correction
Product Name Description Item# QTY
Tocris Bioscience Gastrin I (human), selective CCK2 agonist, 1mg Gastrin I (human) peptide, selective CCK2 agonist, stimulates gastric acid secretion, mitogenic for gastric cells, promotes epithelial cell proliferation, used in stomach, intestine, and pancreas organoid culture, 1mg 2946-30061 EA
Purmorphamine, Smo receptor agonist, 10mg, Tocris Bioscience Purmorphamine, Smo receptor agonist, 10mg, activates Hedgehog pathway, induces osteogenesis in mouse mesenchymal progenitor cells, transdifferentiates pre-adipocytes and myoblasts with BMP-4, induces osteoblast and spinal motor neuron differentiation 2946-455110 EA
2-Furoyl-LIGRLO-amide, potent selective PAR2 agonist, 1mg, Tocris Bioscience 2-Furoyl-LIGRLO-amide from Tocris Bioscience, potent and selective PAR2 agonist (pD2 = 7.0), induces dose-dependent relaxation of murine femoral arteries, quantity: 1mg 2946-30151 EA
SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience SLIGKV-NH2, PAR2 receptor agonist, 5mg, Tocris Bioscience. Ki=9.64 M, IC50=10.4 M. Sequence: Ser-Leu-Ile-Gly-Lys-Val-NH2. Corresponds to tethered ligand exposed by trypsin cleavage of PAR-2. 2946-30105 EA
Calcitonin (human), 500ug, endogenous receptor agonist, Tocris Bioscience Calcitonin (human), 500ug, endogenous calcitonin receptor agonist; inhibits bone resorption; lowers systemic blood calcium. Lyophilized peptide, sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, molecular weight: 3417.87, CAS: 21215-62-3, store at -20 deg. 2946-6031500U EA
Thank you for visiting. We look forward to serving you!

Read more about us:  Franklin Young Value



For Government, Military, Education and Government Prime Access:


New Customers Existing Customers

Please contact Customer Service with your questions.

Thank you for visiting, your account is pending approval.

You will received email notification for approval within 24hrs.

Contact customerservice@franklinyoung.com for any questions.

Thank you for requesting an account with Franklin Young.

Your request has been declined

We restrict website access to government entities, and related customers.

Please contact customerservice@franklinyoung.com with any questions.