Back to Previous Page

Tocris Bioscience Gastrin I (human), selective CCK2 agonist, 1mg

ITEM#: 2946-30061

MFR#: 3006/1

Gastrin I (human) peptide, selective CCK2 agonist, stimulates gastric acid secretion, mitogenic for gastric cells, promotes epithelial cell proliferation, used in stomach, intestine, and pancreas organoid culture, 1mg

See More Details
Gastrin I (human) peptide, selective CCK2 agonist, stimulates gastric acid secretion, mitogenic for gastric cells, promotes epithelial cell proliferation, used in stomach, intestine, and pancreas organoid culture, 1mg
Provide Content Correction
Product Name Description Item# QTY
DAMGO, selective opioid receptor agonist, 1mg, Tocris Bioscience DAMGO, highly selective peptide agonist for the opioid receptor. Supplied as 1mg by Tocris Bioscience. 2946-11711 EA
2-Furoyl-LIGRLO-amide, potent selective PAR2 agonist, 1mg, Tocris Bioscience 2-Furoyl-LIGRLO-amide from Tocris Bioscience, potent and selective PAR2 agonist (pD2 = 7.0), induces dose-dependent relaxation of murine femoral arteries, quantity: 1mg 2946-30151 EA
Calcitonin (human), 500ug, endogenous receptor agonist, Tocris Bioscience Calcitonin (human), 500ug, endogenous calcitonin receptor agonist; inhibits bone resorption; lowers systemic blood calcium. Lyophilized peptide, sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, molecular weight: 3417.87, CAS: 21215-62-3, store at -20 deg. 2946-6031500U EA
YNT 185, potent selective OX2 agonist, 10 mg, Tocris Bioscience YNT 185, potent selective OX2 agonist, EC50 28 nM OX2, 100-fold selectivity over OX1, depolarizes OX2-expressing histaminergic neurons, increases wake time in wild type mice, 10 mg 2946-673910 EA
Caerulein, CCK agonist, 1mg, Tocris Bioscience, CAS: 17650-98-5 Caerulein, CCK agonist, 1mg, CAS: 17650-98-5, Molecular Weight: 1352.4g/mol, Sequence: XQDYTGWMDF, Human, store at -20 deg.C. Stimulates pancreatic enzymes in AR4-2J cells in vitro, induces acute pancreatitis in mice. 2946-62641 EA
Thank you for visiting. We look forward to serving you!

Read more about us:  Franklin Young Value



For Government, Military, Education and Government Prime Access:


New Customers Existing Customers

Please contact Customer Service with your questions.

Thank you for visiting, your account is pending approval.

You will received email notification for approval within 24hrs.

Contact customerservice@franklinyoung.com for any questions.

Thank you for requesting an account with Franklin Young.

Your request has been declined

We restrict website access to government entities, and related customers.

Please contact customerservice@franklinyoung.com with any questions.