Back to Previous Page

Retinoic acid, endogenous RAR agonist, 50mg, Tocris Bioscience

ITEM#: 2946-069550

MFR#: 0695/50

Retinoic acid, 50mg, endogenous RAR agonist (IC50=14 nM), promotes mouse ESC differentiation to adipocytes, neurons, glia in vitro, proposed ROR ligand (Kd=280 nM), activates autophagy, Tocris Bioscience

See More Details
Retinoic acid, 50mg, endogenous RAR agonist (IC50=14 nM), promotes mouse ESC differentiation to adipocytes, neurons, glia in vitro, proposed ROR ligand (Kd=280 nM), activates autophagy, Tocris Bioscience
Provide Content Correction
Product Name Description Item# QTY
Amylin, endogenous peptide agonist, 500ug, Tocris Bioscience Amylin, endogenous peptide agonist for amylin, calcitonin, CGRP and adrenomedullin receptors. Inhibits glucagon secretion, delays gastric emptying, acts as a satiety agent, displays glucose lowering effects in vivo. 500ug, Tocris Bioscience 2946-3418500U EA
Calcitonin (human), 500ug, endogenous receptor agonist, Tocris Bioscience Calcitonin (human), 500ug, endogenous calcitonin receptor agonist; inhibits bone resorption; lowers systemic blood calcium. Lyophilized peptide, sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP, molecular weight: 3417.87, CAS: 21215-62-3, store at -20 deg. 2946-6031500U EA
Poly(I:C), TLR3 agonist, synthetic dsRNA, 50mg, Tocris Bioscience Poly(I:C), synthetic dsRNA, TLR3, RIG-I, MDA-5 agonist, induces type I IFN, pro-inflammatory cytokines, 50mg, promotes immune activation in vivo, cardiomyocyte maturation, dendritic cell generation, Tocris Bioscience 2946-428750 EA
Kainic acid (synthetic), 10 mg, kainate agonist, Tocris Bioscience Kainic acid (synthetic), 10 mg, CAS: 487-79-6, purity 98%, selective kainate receptor agonist (EC50 = 0.6 M - 7.4 M), partial AMPA agonist (EC50 = 31 M - 170 M), used to model epilepsy and study neurodegeneration 2946-706510 EA
Purmorphamine, Smo receptor agonist, 10mg, Tocris Bioscience Purmorphamine, Smo receptor agonist, 10mg, activates Hedgehog pathway, induces osteogenesis in mouse mesenchymal progenitor cells, transdifferentiates pre-adipocytes and myoblasts with BMP-4, induces osteoblast and spinal motor neuron differentiation 2946-455110 EA
Thank you for visiting. We look forward to serving you!

Read more about us:  Franklin Young Value



For Government, Military, Education and Government Prime Access:


New Customers Existing Customers

Please contact Customer Service with your questions.

Thank you for visiting, your account is pending approval.

You will received email notification for approval within 24hrs.

Contact customerservice@franklinyoung.com for any questions.

Thank you for requesting an account with Franklin Young.

Your request has been declined

We restrict website access to government entities, and related customers.

Please contact customerservice@franklinyoung.com with any questions.